WDR55 Antibody - middle region : Biotin

WDR55 Antibody - middle region : Biotin
SKU
AVIARP57011_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: WDR55 is a nucleolar protein that acts as a modulator of rRNA synthesis. WDR55 plays a central role during organogenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WDR55

Key Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: AKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: WD repeat-containing protein 55

Protein Size: 383

Purification: Affinity Purified
More Information
SKU AVIARP57011_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57011_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54853
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×