WDR5B Antibody - N-terminal region : Biotin

WDR5B Antibody - N-terminal region : Biotin
SKU
AVIARP57325_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This intronless gene encodes a protein containing several WD40 repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, including a trp-asp at the C-terminal end. The encoded protein may mediate protein-protein interactions.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human WDR5B

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: DVAWSSDSSRLVSASDDKTLKLWDVRSGKCLKTLKGHSNYVFCCNFNPPS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: WD repeat-containing protein 5B

Protein Size: 330

Purification: Affinity Purified
More Information
SKU AVIARP57325_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57325_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54554
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×