WDR9/BRWD1 (BD2), His-tag Recombinant

WDR9/BRWD1 (BD2), His-tag Recombinant
SKU
BPS31115
Packaging Unit
100 µg
Manufacturer
BPS Bioscience

Availability: loading...
Price is loading...
Products from BPS Bioscience require a minimum order value above 400€

Encompassing Amino Acids: 1308-1436

Amino Acid Sequence: MHHHHHHIRATNYVESNWKKQCKELVNLIFQCEDSEPFRQPVDLVEYPDYRDIIDTPMDFGTVRETLDAGNYDSPLEFCKDIRLIFSNAKAYTPNKRSKIYSMTLRLSALFEEKMKKISSDFKIGQKFNEKLRRSQ

Application: Useful for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling.

Description: Human bromodomain and WD repeat domain containing 1 (BRWD1) or WDR9, GenBank Accession No. NM_018963, a.a. 1308 - 1436 corresponding to bromodomain 2 with N-terminal His-tag, MW = 16.2 kDa, expressed in an E. coli expression system.

Format: Aqueous buffer solution

Formulation: 40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 0.04 % Tween-20, 20% glycerol

Genbank: NM_018963

Storage Stability: At least 6 months at -80°C.

Tags: N-terminal His-tag

Uniprot: Q9NSI6

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. Ramos, VC., et al., Biochim Biophys Acta. 2002 Sep 27;1577(3): 377-83
2. Huang, H., et al., Dev Dyn. 2003 Aug; 227(4): 608-14
More Information
SKU BPS31115
Manufacturer BPS Bioscience
Manufacturer SKU 31115
Package Unit 100 µg
Quantity Unit STK
Host Escherichia Coli
Product information (PDF) Download
MSDS (PDF)
×