WDTC1 Antibody - N-terminal region : FITC

WDTC1 Antibody - N-terminal region : FITC
SKU
AVIARP55145_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: WDTC1 contains 2 TPR repeats and 7 WD repeats. WDTC1, the ortholog of Drosophila Adipose Gene, associates with human obesity, modulated by MUFA intake.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human WDTC1

Key Reference: Hader,T., (2003) EMBO Rep. 4 (5), 511-516

Molecular Weight: 76kDa

Peptide Sequence: Synthetic peptide located within the following region: PMWPNTFWSAAEDGLIRQYDLRENSKHSEVLIDLTEYCGQLVEAKCLTVN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: WD and tetratricopeptide repeats protein 1

Protein Size: 676

Purification: Affinity Purified
More Information
SKU AVIARP55145_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55145_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23038
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×