WFDC1 Antibody - middle region : FITC

WFDC1 Antibody - middle region : FITC
SKU
AVIARP57526_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the WAP-type four disulfide core domain family. The WAP-type four-disulfide core domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. The encoded protein shares 81% amino acid identity with the rat ps20 protein, which was originally identified as a secreted growth inhibitor. This gene is mapped to chromosome 16q24, an area of frequent loss of heterozygosity in cancers, including prostate, breast and hepatocellular cancers and Wilms' tumor. Owing to its location and a possible growth inhibitory property of its gene product, this gene is suggested to be a tumor suppressor gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WFDC1

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: VAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: WAP four-disulfide core domain protein 1

Protein Size: 220

Purification: Affinity Purified
More Information
SKU AVIARP57526_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57526_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Pig (Porcine), Dog (Canine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 58189
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×