XPNPEP3 Antibody - N-terminal region : Biotin

XPNPEP3 Antibody - N-terminal region : Biotin
SKU
AVIARP57593_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human XPNPEP3

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: PVPERRIPNRYLGQPSPFTHPHLLRPGEVTPGLSQVEYALRRHKLMSLIQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Probable Xaa-Pro aminopeptidase 3

Protein Size: 507

Purification: Affinity Purified
More Information
SKU AVIARP57593_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57593_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 63929
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×