YKL-39 antibody

YKL-39 antibody
SKU
GTX04608-100
Packaging Unit
100 μl
Manufacturer
GeneTex

Availability: loading...
Price is loading...
Calculated MW: 44

Form: Liquid

Buffer (with preservative): PBS, 2% sucrose, 0.09% sodium azide.

Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Background: The protein encoded by this gene is similar to bacterial chitinases but lacks chitinase activity. The encoded protein is secreted and is involved in cartilage biogenesis. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012]

Uniprot ID: Q15782

Antigen Species: Human

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHI3L2 protein: KLAKDLDFINLLSFDFHGSWEKPLITGHNSPLSKGWQDRGPSSYYNVEYA

Purification: Purified by affinity chromatography

Conjugation: Unconjugated

Full Name: chitinase 3 like 2
More Information
SKU GTX04608-100
Manufacturer GeneTex
Manufacturer SKU GTX04608-100
Package Unit 100 μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Isotype IgG
Human Gene ID 1117
Host Rabbit
Conjugate Unconjugated
Product information (PDF) Download
MSDS (PDF)
×