YTHDF3 Antibody - N-terminal region : FITC

YTHDF3 Antibody - N-terminal region : FITC
SKU
AVIARP55529_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: YTHDF3 contains 1 YTH domain. The functions of YTHDF3 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human YTHDF3

Key Reference: Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: GEAAWSTAGDQPMPYLTTYGQMSNGEHHYIPDGVFSQPGALGNTPPFLGQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: YTH domain family protein 3

Protein Size: 585

Purification: Affinity Purified
More Information
SKU AVIARP55529_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55529_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 253943
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×