YTHDF3 Antibody - N-terminal region : HRP

YTHDF3 Antibody - N-terminal region : HRP
SKU
AVIARP55530_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: YTHDF3 contains 1 YTH domain. The functions of YTHDF3 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human YTHDF3

Key Reference: Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: QPGALGNTPPFLGQHGFNFFPGNADFSTWGTSGSQGQSTQSSAYSSSYGY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: YTH domain family protein 3

Protein Size: 585

Purification: Affinity Purified
More Information
SKU AVIARP55530_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55530_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 253943
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×