ZADH2 Antibody - N-terminal region : Biotin

ZADH2 Antibody - N-terminal region : Biotin
SKU
AVIARP55746_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The exact functions of ZADH2 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZADH2

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: MLRLVPTGARAIVDMSYARHFLDFQGSAIPQAMQKLVVTRLSPNFREAVT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc-binding alcohol dehydrogenase domain-containing protein 2

Protein Size: 377

Purification: Affinity Purified
More Information
SKU AVIARP55746_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55746_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 284273
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×