Zar1l Antibody - C-terminal region : Biotin

Zar1l Antibody - C-terminal region : Biotin
SKU
AVIARP58201_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Zar1l

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: SQLLLPTWSRDREEQFPRLKELGEEYAHSPQDRKGKQFLELKYGYFHCKD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein Zar1l Ensembl ENSMUSP00000114116

Protein Size: 291

Purification: Affinity Purified
More Information
SKU AVIARP58201_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58201_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Mouse (Murine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 545824
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×