ZBED8 Antibody - N-terminal region : Biotin

ZBED8 Antibody - N-terminal region : Biotin
SKU
AVIARP57587_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LOC63920

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: SVFSNADLRPSKLSDHFNRQHGGVAGHDLNSLKHMPAPSDQSETLKAFGV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: protein ZBED8

Protein Size: 594

Purification: Affinity Purified
More Information
SKU AVIARP57587_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57587_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 63920
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×