ZCCHC13 Antibody - middle region : Biotin

ZCCHC13 Antibody - middle region : Biotin
SKU
AVIARP55945_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZCCHC13

Key Reference: Lim,J., (2006) Cell 125 (4), 801-814

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: GKLGHIQKDCAQVKCYRCGEIGHVAINCSKARPGQLLPLRQIPTSSQGMS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger CCHC domain-containing protein 13

Protein Size: 166

Purification: Affinity Purified
More Information
SKU AVIARP55945_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55945_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 389874
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×