ZCCHC14 Antibody - N-terminal region : Biotin

ZCCHC14 Antibody - N-terminal region : Biotin
SKU
AVIARP55181_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: ZCCHC14 contains 1 CCHC-type zinc finger. The function of ZCCHC14 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZCCHC14

Key Reference: Nakajima,D., (2002) DNA Res. 9 (3), 99-106

Molecular Weight: 100kDa

Peptide Sequence: Synthetic peptide located within the following region: RYLASLPSHVLKNDHVRRFLSTSSPPQQLQSPSPGNPSLSKVGTVMGVSG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger CCHC domain-containing protein 14

Protein Size: 949

Purification: Affinity Purified
More Information
SKU AVIARP55181_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55181_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23174
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×