ZCCHC14 Antibody - N-terminal region : HRP

ZCCHC14 Antibody - N-terminal region : HRP
SKU
AVIARP55181_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ZCCHC14 contains 1 CCHC-type zinc finger. The function of ZCCHC14 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZCCHC14

Key Reference: Nakajima,D., (2002) DNA Res. 9 (3), 99-106

Molecular Weight: 100kDa

Peptide Sequence: Synthetic peptide located within the following region: RYLASLPSHVLKNDHVRRFLSTSSPPQQLQSPSPGNPSLSKVGTVMGVSG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Zinc finger CCHC domain-containing protein 14

Protein Size: 949

Purification: Affinity Purified
More Information
SKU AVIARP55181_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55181_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23174
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×