Zcchc8 Antibody - C-terminal region : Biotin

Zcchc8 Antibody - C-terminal region : Biotin
SKU
AVIARP56986_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Zcchc8

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: FQPPLPPGTPPPLPQGTPPPLFTPPLPKGTPPLTPSDSPQPRPTASGVDE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 476

Purification: Affinity Purified
More Information
SKU AVIARP56986_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56986_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 288661
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×