ZDHHC24 Antibody - middle region : Biotin

ZDHHC24 Antibody - middle region : Biotin
SKU
AVIARP55989_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZDHHC24

Key Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: QHSYDLGPCHNLQAALGPRWALVWLWPFLASPLPGDGITFQTTADVGHTA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Probable palmitoyltransferase ZDHHC24

Protein Size: 284

Purification: Affinity Purified
More Information
SKU AVIARP55989_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55989_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 254359
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×