ZFPL1 Antibody - middle region : Biotin

ZFPL1 Antibody - middle region : Biotin
SKU
AVIARP58101_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: ZFPL1 is expressed strongly in the exocrine pancreas as a 1.4-kb polyadenylated RNA encoding a putative protein of 310 amino acids.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZFPL1

Key Reference: Chiu,C.F., (2008) EMBO J. 27 (7), 934-947

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: LLQRAGLLLLLGLLGFLALLALMSRLGRAAADSDPNLDPLMNPHIRVGPS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger protein-like 1

Protein Size: 310

Purification: Affinity Purified
More Information
SKU AVIARP58101_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58101_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 7542
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×