ZNF134 Antibody - middle region : HRP

ZNF134 Antibody - middle region : HRP
SKU
AVIARP58103_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ZNF134 is a candidate transcription factor.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF134

Key Reference: Tommerup,N. (1995) Genomics 27 (2), 259-264

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: TLGGCQQKAIHSKRKTHRSTESGDAFHGEQMHYKCSECGKAFSRKDTLVQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Zinc finger protein 134

Protein Size: 427

Purification: Affinity Purified
More Information
SKU AVIARP58103_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58103_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 7693
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×