ZNF257 Antibody - N-terminal region : HRP

ZNF257 Antibody - N-terminal region : HRP
SKU
AVIARP57954_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of ZNF257 has not yet been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF257

Key Reference: Han,Z.G., (1999) J. Biol. Chem. 274 (50), 35741-35748

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: PPVMCSHIAEDLCPERDIKYFFQKVILRRYDKCEHENLQLRKGCKSVDEC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Zinc finger protein 257

Protein Size: 563

Purification: Affinity Purified
More Information
SKU AVIARP57954_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57954_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 113835
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×