ZNF334 Antibody - N-terminal region : HRP

ZNF334 Antibody - N-terminal region : HRP
SKU
AVIARP58055_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ZNF334 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 14 C2H2-type zinc fingers and 1 KRAB domain. ZNF334 may be involved in transcriptional regulation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF334

Key Reference: Deloukas,P., (2001) Nature 414 (6866), 865-871

Molecular Weight: 80kDa

Peptide Sequence: Synthetic peptide located within the following region: KMKKFQIPVSFQDLTVNFTQEEWQQLDPAQRLLYRDVMLENYSNLVSVGY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Zinc finger protein 334

Protein Size: 680

Purification: Affinity Purified
More Information
SKU AVIARP58055_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58055_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55713
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×