ZNF44 Antibody - N-terminal region : Biotin

ZNF44 Antibody - N-terminal region : Biotin
SKU
AVIARP58043_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: ZNF44 may be involved in transcriptional regulation.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF44

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: NLRRNPRCDVVERFGKSKDGSQCGETLSQIRNSIVNKNTPARVDACGSSV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger protein 44

Protein Size: 589

Purification: Affinity Purified
More Information
SKU AVIARP58043_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58043_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51710
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×