ZNF676 Antibody - middle region : Biotin

ZNF676 Antibody - middle region : Biotin
SKU
AVIARP58109_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: ZNF676 may be involved in transcriptional regulation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ZNF676

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: SSTLTYYKSIHTGEKPYKCEECGKAFSKFSILTKHKVIHTGEKPYKCEEC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger protein 676

Protein Size: 588

Purification: Affinity Purified
More Information
SKU AVIARP58109_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58109_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 163223
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×