ZP1 Antibody - middle region : FITC

ZP1 Antibody - middle region : FITC
SKU
AVIARP55990_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The mammalian zona pellucida, which mediates species-specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP1 ensures the structural integrity of the zona pellucida.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZP1

Key Reference: Gook,D.A., (2008) Hum. Reprod. 23 (2), 394-402

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: TLEHWDVNKRDYIGTHLSQEQCQVASGHLPCIVRRTSKEACQQAGCCYDN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zona pellucida sperm-binding protein 1

Protein Size: 638

Purification: Affinity Purified
More Information
SKU AVIARP55990_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55990_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 22917
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×