ABHD15 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LOC116236

Key Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: QTLCHFVLPVAPGPELAREYLQLADDGLVALDWVVGPCVRGRRITSAGGL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Abhydrolase domain-containing protein 15

Protein Size: 468

Purification: Affinity Purified

• SKU: AVIARP53458_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53458_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 116236
• Host: Rabbit
• Conjugate: Conjugated, Biotin