ABRAXAS2 Antibody - middle region : Biotin

ABRAXAS2 Antibody - middle region : Biotin
SKU
AVIARP55402_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA0157

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: FAAEGRSTLGDAEASDPPPPYSDFHPNNQESTLSHSRMERSVFMPRPQAV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: BRISC complex subunit Abraxas 2

Protein Size: 415

Purification: Affinity Purified

Subunit: Abro1
More Information
SKU AVIARP55402_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55402_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23172
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×