ACAD8 Antibody - N-terminal region : Biotin

ACAD8 Antibody - N-terminal region : Biotin
SKU
AVIARP55038_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. The encoded protein is a mitochondrial enzyme that functions in catabolism of the branched-chain amino acid valine. Defects in this gene are the cause of isobutyryl-CoA dehydrogenase deficiency.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human ACAD8

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: KFASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGAGESDIYVV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: isobutyryl-CoA dehydrogenase, mitochondrial

Protein Size: 357

Purification: Affinity Purified
More Information
SKU AVIARP55038_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55038_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Clonality Polyclonal
Application Western Blotting
Human Gene ID 27034
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×