ACBD3 Antibody - N-terminal region : HRP

ACBD3 Antibody - N-terminal region : HRP
SKU
AVIARP57649_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACBD3

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: EARRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Golgi resident protein GCP60

Protein Size: 528

Purification: Affinity Purified
More Information
SKU AVIARP57649_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57649_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 64746
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×