ACD Antibody - middle region : FITC

ACD Antibody - middle region : FITC
SKU
AVIARP58253_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ACD is a protein that is involved in telomere function. This protein is one of six core proteins in the telosome/shelterin telomeric complex, which functions to maintain telomere length and to protect telomere ends. Through its interaction with other comp

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACD

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: KNRPPFPRTGATRGAQEPCSVWEPPKRHRDGSAFQYEYEPPCTSLCARVQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Adrenocortical dysplasia protein homolog

Protein Size: 544

Purification: Affinity Purified
More Information
SKU AVIARP58253_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58253_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 65057
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×