ACO2 Antibody - C-terminal region : FITC

ACO2 Antibody - C-terminal region : FITC
SKU
AVIARP56302_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ACO2 belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ACO2

Molecular Weight: 82kDa

Peptide Sequence: Synthetic peptide located within the following region: RYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHET

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Aconitate hydratase, mitochondrial

Protein Size: 780

Purification: Affinity Purified
More Information
SKU AVIARP56302_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56302_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Pig (Porcine), Cow (Bovine), Yeast
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 50
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×