ACOT11 Antibody - middle region : FITC

ACOT11 Antibody - middle region : FITC
SKU
AVIARP55281_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ACOT11 is a protein with acyl-CoA thioesterase activity towards medium (C12) and long-chain (C18) fatty acyl-CoA substrates. Expression of a similar murine protein in brown adipose tissue is induced by cold exposure and repressed by warmth. Expression of the mouse protein has been associated with obesity, with higher expression found in obesity-resistant mice compared with obesity-prone mice.This gene encodes a protein with acyl-CoA thioesterase activity towards medium (C12) and long-chain (C18) fatty acyl-CoA substrates. Expression of a similar murine protein in brown adipose tissue is induced by cold exposure and repressed by warmth. Expression of the mouse protein has been associated with obesity, with higher expression found in obesity-resistant mice compared with obesity-prone mice. Alternative splicing results in two transcript variants encoding different isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACOT11

Key Reference: Hunt,M.C., (2006) FASEB J. 20 (11), 1855-1864

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: YVIALRSVTLPTHRETPEYRRGETLCSGFCLWREGDQLTKCCWVRVSLTE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Acyl-coenzyme A thioesterase 11

Protein Size: 607

Purification: Affinity Purified
More Information
SKU AVIARP55281_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55281_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26027
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×