Anti-ADAMTS4

ADAM metallopeptidase with thrombospondin type 1 motif, 4, Polyclonal, IgG, Rabbit

Sequence: VEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALLGVLQYRGAELHLQPLEGGTPNSAGGPGAHILRRKSPASGQGPMCN

GeneName: ADAMTS4

Ensembl Gene ID: ENSG00000158859

UniProt ID: O75173

Entrez Gene ID: 9507

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.05

Interspecies Mouse/Rat: ENSMUSG00000006403: 95%, ENSRNOG00000003538: 92%

Enhanced Validation: No

• SKU: ATLHPA051296-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA051296-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 9507
• Host: Rabbit
• Conjugate: Unconjugated