AGBL5 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: AGBL5 belongs to the peptidase M14 family. The exact function of AGBL5 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human AGBL5

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: NLRAWMLKHVRNSRGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytosolic carboxypeptidase-like protein 5

Protein Size: 427

Purification: Affinity Purified

• SKU: AVIARP53752_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53752_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 60509
• Host: Rabbit
• Conjugate: Conjugated, Biotin