AHR antibody

AHR antibody
SKU
GTX03719-100
Packaging Unit
100 μg
Manufacturer
GeneTex

Availability: loading...
Price is loading...
Application Note: WB: 0.1-0.5μg/ml. ICC/IF: 0.5-1μg/ml. IHC-P: 0.5-1μg/ml. FACS: 1-3μg/1x106 cells. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.

Calculated MW: 96

Form: Liquid

Buffer (with preservative): 4mg Trehalose, 0.9mg NaCl, 0.2mg Na₂HPO₄, 0.05mg sodium azide.

Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Background: The protein encoded by this gene is a ligand-activated helix-loop-helix transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. This receptor has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. Before ligand binding, the encoded protein is sequestered in the cytoplasm; upon ligand binding, this protein moves to the nucleus and stimulates transcription of target genes. [provided by RefSeq, Sep 2015]

Uniprot ID: P35869

Antigen Species: Human

Immunogen: A synthetic peptide corresponding to a sequence of human AHR (AFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHH).

Purification: Purified by antigen-affinity chromatography

Conjugation: Unconjugated

Full Name: aryl hydrocarbon receptor
More Information
SKU GTX03719-100
Manufacturer GeneTex
Manufacturer SKU GTX03719-100
Package Unit 100 μg
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus)
Clonality Polyclonal
Application Immunofluorescence, Immunohistochemistry (paraffin), Western Blotting, Flow Cytometry, Immunocytochemistry
Isotype IgG
Human Gene ID 196
Host Rabbit
Conjugate Unconjugated
Product information (PDF) Download
MSDS (PDF)
×