AIP Antibody - middle region : FITC

AIP Antibody - middle region : FITC
SKU
AVIARP58131_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a receptor for aryl hydrocarbons and a ligand-activated transcription factor. The encoded protein is found in the cytoplasm as part of a multiprotein complex, but upon binding of ligand is transported to the nucleus. This protein can regulate the expression of many xenobiotic metabolizing enzymes. Also, the encoded protein can bind specifically to and inhibit the activity of hepatitis B virus.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AIP

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: NAQEAQADFAKVLELDPALAPVVSRELQALEARIRQKDEEDKARFRGIFS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: AH receptor-interacting protein

Protein Size: 330

Purification: Affinity Purified
More Information
SKU AVIARP58131_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58131_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 9049
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×