AIP Antibody - N-terminal region : HRP

AIP Antibody - N-terminal region : HRP
SKU
AVIARP58132_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: AIP may play a positive role in AHR-mediated signalling possibly by influencing its receptivity for ligand and/or its nuclear targeting. AIP is the cellular negative regulator of the HBV X protein. AIP may play a positive role in AHR-mediated signalling possibly by influencing its receptivity for ligand and/or its nuclear targeting. AIP is the cellular negative regulator of the HBV X protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AIP

Key Reference: Buchbinder,S., (er) Exp. Clin. Endocrinol. Diabetes (2008) In press

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: FHYRTLHSDDEGTVLDDSRARGKPMELIIGKKFKLPVWETIVCTMREGEI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: AH receptor-interacting protein

Protein Size: 330

Purification: Affinity Purified
More Information
SKU AVIARP58132_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58132_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 9049
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×