ALAS1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Delta-aminolevulinate synthase (ALAS; EC 2.3.1.37) catalyzes the condensation of glycine with succinyl-CoA to form delta-aminolevulinic acid. This nuclear-encoded mitochondrial enzyme is the first and rate-limiting enzyme in the mammalian heme biosynthetic pathway. There are 2 tissue-specific isozymes: a housekeeping enzyme encoded by the ALAS1 gene and an erythroid tissue-specific enzyme encoded by ALAS2.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ALAS1

Key Reference: Jung,M., (2007) Urologe A 46 (9), 1083-1084

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: ETSAGPSVVSVKTDGGDPSGLLKNFQDIMQKQRPERVSHLLQDNLPKSVS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 5-aminolevulinate synthase, nonspecific, mitochondrial

Protein Size: 640

Purification: Affinity Purified

• SKU: AVIARP54346_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54346_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 211
• Host: Rabbit
• Conjugate: Conjugated, FITC