ALOX15 Antibody - middle region : Biotin

ALOX15 Antibody - middle region : Biotin
SKU
AVIARP56030_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: ALOX15 converts arachidonic acid to 15S-hydroperoxyeicosatetraenoic acid. ALOX15 also acts on C-12 of arachidonate as well as on linoleic acid.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ALOX15

Key Reference: McCaskie,P.A., (2008) Hum. Genet. 123 (5), 445-453

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Arachidonate 15-lipoxygenase

Protein Size: 662

Purification: Affinity Purified
More Information
SKU AVIARP56030_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56030_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 246
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×