Amy1a Antibody - middle region : Biotin

Amy1a Antibody - middle region : Biotin
SKU
AVIARP54700_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Amy1a

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: YLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKMAV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Alpha-amylase EMBL BAB39466.1

Protein Size: 521

Purification: Affinity Purified
More Information
SKU AVIARP54700_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54700_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 24203
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×