ANGPTL2 Antibody - middle region : Biotin

ANGPTL2 Antibody - middle region : Biotin
SKU
AVIARP54836_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Angiopoietins are members of the vascular endothelial growth factor family and the only known growth factors largely specific for vascular endothelium. Angiopoietin-1, angiopoietin-2, and angiopoietin-4 participate in the formation of blood vessels. ANGPTL2 protein is a secreted glycoprotein with homology to the angiopoietins and may exert a function on endothelial cells through autocrine or paracrine action.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ANGL2

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: PPAAPPRVYQPPTYNRIINQISTNEIQSDQNLKVLPPPLPTMPTLTSLPS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: angiopoietin-related protein 2

Protein Size: 493

Purification: Affinity purified
More Information
SKU AVIARP54836_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54836_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23452
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×