ANKRD47 Antibody - N-terminal region : Biotin

ANKRD47 Antibody - N-terminal region : Biotin
SKU
AVIARP55872_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ANKRD47

Key Reference: Zhu,Y., (2008) Biochim. Biophys. Acta 1780 (2), 128-133

Molecular Weight: 86kDa

Peptide Sequence: Synthetic peptide located within the following region: GPAQLQLVREQMAAALRRLRELEDQARTLPELQEQVRALRAEKARLLAGR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: KN motif and ankyrin repeat domain-containing protein 3

Protein Size: 821

Purification: Affinity Purified
More Information
SKU AVIARP55872_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55872_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 256949
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×