ANKRD7 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ANKRD7 contains 5 ANK repeats. The exact function of ANKRD7 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ANKRD7

Key Reference: Ozaki,K., (1996) Genomics 36 (2), 316-319

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: EYEADLEAKNKDGYTPLLVAVINNNPKMVKFLLEKGADVNASDNYQRTAL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ankyrin repeat domain-containing protein 7

Protein Size: 151

Purification: Affinity Purified

• SKU: AVIARP53739_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53739_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 56311
• Host: Rabbit
• Conjugate: Conjugated, FITC