Anti-ABTB3

ankyrin repeat and BTB domain containing 3, Polyclonal, IgG, Rabbit

GeneName: ABTB3

Concentration: 0,2

Sequence: AMHHLQPLNAKHHGNGTPLHHKQGALYWEPEALYTLCYFMHCPQMEWENPNVEPSKVNLQVERP

InterspeciesReactivity: ENSMUSG00000020042: 98%, ENSRNOG00000005758: 98%

Entrez Gene ID: 121551

Uniprot ID: A6QL63

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal ABTB3 Antibody against Human ankyrin repeat and BTB domain containing 3. Validated for Western Blot

• SKU: ATLHPA068658-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA068658-25
• Package Unit: 25UL
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 121551
• Host: Rabbit
• Conjugate: Unconjugated