Anti-ADAMTS16

ADAM metallopeptidase with thrombospondin type 1 motif 16, Polyclonal, IgG, Rabbit

Sequence: GLSGMIRTEEADYFLRPLPSHLSWKLGRAAQGSSPSHVLYKRSTEPHAPGASEVLVTSRTWELAHQPLHS

GeneName: ADAMTS16

Ensembl Gene ID: ENSG00000145536

UniProt ID: Q8TE57

Entrez Gene ID: 170690

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.6

Interspecies Mouse/Rat: ENSMUSG00000049538: 63%, ENSRNOG00000016812: 61%

Enhanced Validation: No

• SKU: ATLHPA067668-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA067668-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting, Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 170690
• Host: Rabbit
• Conjugate: Unconjugated