Anti-AGGF1

angiogenic factor with G patch and FHA domains 1, Polyclonal, IgG, Rabbit

GeneName: AGGF1

Concentration: 0,5

Sequence: VEELSKILQRGRNEDNKKSDVEVQTENHAPWSISDYFYQTYYNDVSLPNKVTELSDQQDQAIETSILNSKDHLQVENDAYPGTDRTENVKYRQVDHFASNSQEPA

InterspeciesReactivity: ENSMUSG00000021681: 58%, ENSRNOG00000029304: 57%

Entrez Gene ID: 55109

Uniprot ID: Q8N302

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal AGGF1 Antibody against Human angiogenic factor with G-patch and FHA domains 1. Validated for Western Blot

• SKU: ATLHPA037644-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA037644-100
• Package Unit: 100UL
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 55109
• Host: Rabbit
• Conjugate: Unconjugated