Anti-ANKS4B

ankyrin repeat and sterile alpha motif domain containing 4B, Polyclonal, IgG, Rabbit

Sequence: TFGSLSKGIKDTFKIKFKKNKDTAEQVGKEGRSGQRNVMEVFREEEEDSFSGDFKEKLQLSAEEDGSVHHESILNRPGLG

GeneName: ANKS4B

Ensembl Gene ID: ENSG00000175311

UniProt ID: Q8N8V4

Entrez Gene ID: 257629

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.4

Interspecies Mouse/Rat: ENSMUSG00000030909: 81%, ENSRNOG00000046181: 78%

Enhanced Validation: Yes

• SKU: ATLHPA061125-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA061125-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunohistochemistry
• Isotype: IgG
• Human Gene ID: 257629
• Host: Rabbit
• Conjugate: Unconjugated