Anti-CAD

carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase, Polyclonal, IgG, Rabbit

Sequence: SHLPIVAHAEQQTVAAVLMVAQLTQRSVHICHVARKEEILLIKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGEVRPELGSRQDVEALWENMAVIDCFASDHAPHTLEEKCGSR

GeneName: CAD

Ensembl Gene ID: ENSG00000084774

UniProt ID: P27708

Entrez Gene ID: 790

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.1

Interspecies Mouse/Rat: ENSMUSG00000013629: 89%, ENSRNOG00000026474: 89%

Enhanced Validation: Yes

• SKU: ATLHPA069341-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA069341-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Isotype: IgG
• Human Gene ID: 790
• Host: Rabbit
• Conjugate: Unconjugated