CloneID: 4F-6
Heavy Chain modification: Fc Silent™
Antigen Long Description: The original antibody was generated by immunizing BALB/c mice with the antigenic peptide sequence NGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDC.
Buffer Composition: PBS with 0.02% Proclin 300.
Chimeric Use Statement: This is a reformatted human IgG1 Fc Silent™ antibody, based on the original human IgG1 format, created for improved compatibility with existing reagents, assays and techniques.
Available Custom Conjugation Options: AP, HRP, Fluorescein, APC, PE, Biotin Type A, Biotin Type B, Streptavidin, FluoroProbes 647H, Atto488, APC/Cy7, PE/Cy7
Uniprot Accession No.: P42574
Specificity Statement: The antibody is specific for Caspase-3. The antibody does not cross react with Caspase-7, Caspase-8, GST and BSA.
Application Notes (Clone): The specificity of the original format of the antibody was confirmed by ELISA analysis (EC50= 0.09956μg/mL). The antibody detected Caspase-3 by western blot analysis. The original format of the antibody could inhibit the activity of Caspase-3 protein in cells, inhibit cell apoptosis, and prolong the cryopreservation of the cells cycle (CN116270413A).