CloneID: 4F-6
Antigen Long Description: The original antibody was generated by immunizing BALB/c mice with the antigenic peptide sequence NGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDC.
Buffer Composition: PBS only.
Uniprot Accession No.: P42574
Specificity Statement: The antibody is specific for Caspase-3. The antibody does not cross react with Caspase-7, Caspase-8, GST and BSA.
Application Notes (Clone): The specificity of the original format of the antibody was confirmed by ELISA analysis (EC50= 0.09956μg/mL). The antibody detected Caspase-3 by western blot analysis. The original format of the antibody could inhibit the activity of Caspase-3 protein in cells, inhibit cell apoptosis, and prolong the cryopreservation of the cells cycle (CN116270413A).