Anti-CPSF1

cleavage and polyadenylation specific factor 1, 160kDa, Polyclonal, IgG, Rabbit

Sequence: AISLNITQKVHPVIWSLTSLPFDCTQALAVPKPIGGVVVFAVNSLLYLNQSVPPYGVALNSLTTGTTAFPLRT

GeneName: CPSF1

Ensembl Gene ID: ENSG00000071894

UniProt ID: Q10570

Entrez Gene ID: 29894

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.05

Interspecies Mouse/Rat: ENSMUSG00000034022: 99%, ENSRNOG00000030705: 99%

Enhanced Validation: No

• SKU: ATLHPA068906-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA068906-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 29894
• Host: Rabbit
• Conjugate: Unconjugated